PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G324700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 181aa    MW: 20644.6 Da    PI: 10.0245
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G324700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.93.6e-273686252
              RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                         k +++e +s++Fs+pi++AA+eL+v++T LK++CR++GI+RWPhRk+ksl
  Sevir.1G324700.1.p 36 AKALTFELVSQHFSMPIEQAARELNVGVTGLKKRCRELGIPRWPHRKVKSL 86
                        589**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.18921106IPR003035RWP-RK domain
PfamPF020426.3E-233986IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSSLDTAREK SRKLDYDSVE QATQVQGRPA GGGSEAKALT FELVSQHFSM PIEQAARELN  60
VGVTGLKKRC RELGIPRWPH RKVKSLQTLI DNVQELGKET EEVDGHLTRI VVERLQQTKK  120
LIEERPEVPL DEKTKQLSQA CYKENWKRKR GSRPGAGLRS DLDAQRRWPW FMTCLLHNLN  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955210.11e-108PREDICTED: protein RKD1
SwissprotQ9M9U91e-37RKD1_ARATH; Protein RKD1
TrEMBLK3Z0V51e-70K3Z0V5_SETIT; Uncharacterized protein
STRINGSi020172m3e-70(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-39RWP-RK domain-containing protein